Mouse Anti-Chimpanzee APOC1 Antibody (MO-AB-22688W)
Cat: MO-AB-22688W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO22688W |
Specificity | This antibody binds to Chimpanzee APOC1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. |
Product Overview | Mouse Anti-Chimpanzee APOC1 Antibody is a mouse antibody against APOC1. It can be used for APOC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Apolipoprotein C-I; APOC1 |
UniProt ID | K7C9T7 |
Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQNELSAKMREWFSETFQKVKEKLKIDS. |
See other products for " Apoc1 "
MO-AB-24117H | Mouse Anti-Rat Apoc1 Antibody (MO-AB-24117H) |
MO-AB-08986W | Mouse Anti-Cat APOC1 Antibody (MO-AB-08986W) |
MO-AB-28994W | Mouse Anti-Dog APOC1 Antibody (MO-AB-28994W) |
MO-AB-07231Y | Mouse Anti-Rabbit APOC1 Antibody (MO-AB-07231Y) |
MOFY-0722-FY214 | Rabbit Anti-APOC1 Antibody (MOFY-0722-FY214) |
MOFY-0622-FY59 | Rabbit Anti-APOC1 Antibody (MOFY-0622-FY59) |
CBMOAB-36061FYA | Mouse Anti-Rhesus APOC1 Antibody (CBMOAB-36061FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry