Mouse Anti-Chimpanzee ARPC3 Antibody (MO-AB-21316W)


Cat: MO-AB-21316W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO21316W
SpecificityThis antibody binds to Chimpanzee ARPC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Chimpanzee ARPC3 Antibody is a mouse antibody against ARPC3. It can be used for ARPC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin-related protein 2 / 3 complex subunit 3; Arp2 / 3 complex 21 kDa subunit; ARPC3
UniProt IDK7DC39
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPVPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry