Mouse Anti-Chimpanzee BST1 Antibody (MO-AB-10964W)


Cat: MO-AB-10964W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO10964W
SpecificityThis antibody binds to Chimpanzee BST1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population.
Product OverviewMouse Anti-Chimpanzee BST1 Antibody is a mouse antibody against BST1. It can be used for BST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBone marrow stromal cell antigen 1; BST1
UniProt IDH2RAA9
Protein RefseqThe length of the protein is 318 amino acids long.
The sequence is show below: MAAQGCAASRLLQLLLQLLLPLLLLAAGGARARWRGEGTSAQLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFAENTRRFMPLSDALYGRVADFLSWCRQENDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITQIEIWVMHEIGGPNVESCREGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCVLKSAAAATQRKAPSLYTEQSAGLIIPLLLVLASGTQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry