Mouse Anti-Chimpanzee CA2 Antibody (MO-AB-23920W)


Cat: MO-AB-23920W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO23920W
SpecificityThis antibody binds to Chimpanzee CA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Chimpanzee CA2 Antibody is a mouse antibody against CA2. It can be used for CA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbonic anhydrase II; CA2
UniProt IDH2QWD5
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYGQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPHGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK.
See other products for " CA2 "
MOFY-0722-FY99Biotin conjugated antibody to CA2 Antibody (MOFY-0722-FY99)
MOFY-0722-FY450Rabbit Anti-CA2 Antibody (MOFY-0722-FY450)
MO-AB-09357RMouse Anti-Cattle CA2 Antibody (MO-AB-09357R)
MOFY-0722-FY221Rabbit Anti-CA2 Antibody (MOFY-0722-FY221)
MOFY-0722-FY127HRP conjugated antibody to CA2 Antibody (MOFY-0722-FY127)
MO-AB-10784YMouse Anti-O. mykiss CA2 Antibody (MO-AB-10784Y)
CBMOAB-25628FYCMouse Anti-Arabidopsis CA2 Antibody (CBMOAB-25628FYC)
MO-AB-07385YMouse Anti-Rabbit CA2 Antibody (MO-AB-07385Y)
MO-AB-52041WMouse Anti-Marmoset CA2 Antibody (MO-AB-52041W)
MO-AB-14421YMouse Anti-Sheep CA2 Antibody (MO-AB-14421Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry