Mouse Anti-Chimpanzee CD36 Antibody (MO-AB-17470W)


Cat: MO-AB-17470W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO17470W
SpecificityThis antibody binds to Chimpanzee CD36.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD36 (CD36 Molecule) is a Protein Coding gene. Diseases associated with CD36 include Platelet Glycoprotein Iv Deficiency and Malaria. Among its related pathways are Cytokine Signaling in Immune system and Aryl Hydrocarbon Receptor. Gene Ontology (GO) annotations related to this gene include lipid binding and low-density lipoprotein particle binding. An important paralog of this gene is SCARB2.
Product OverviewMouse Anti-Chimpanzee CD36 Antibody is a mouse antibody against CD36. It can be used for CD36 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD36 molecule; Thrombospondin receptor; CD36
UniProt IDH2QUU6
Protein RefseqThe length of the protein is 472 amino acids long.
The sequence is show below: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDPEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMVLNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSKKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry