Mouse Anti-Chimpanzee CD55 Antibody (MO-AB-25824W)


Cat: MO-AB-25824W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO25824W
SpecificityThis antibody binds to Chimpanzee CD55.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD55 (CD55 Molecule (Cromer Blood Group)) is a Protein Coding gene. Diseases associated with CD55 include Complement Hyperactivation, Angiopathic Thrombosis, And Protein-Losing Enteropathy and Blood Group, Cromer System. Among its related pathways are Creation of C4 and C2 activators and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include lipid binding and virus receptor activity. An important paralog of this gene is C4BPA.
Product OverviewMouse Anti-Chimpanzee CD55 Antibody is a mouse antibody against CD55. It can be used for CD55 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD55 molecule, decay accelerating factor for complement; Cromer blood group; CD55
UniProt IDK7CPK7
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: MTVARPRVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPEVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSTKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPDGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIHCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSDSRPVTQAGMRWCDRSSLQSRTPGFKRSFHFSLPSSWYYRAHVFHIDRFAWDASNRGLADLAKEELRRKYTQVYGLFLVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry