Mouse Anti-Chimpanzee CDK9 Antibody (MO-AB-12476W)


Cat: MO-AB-12476W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO12476W
SpecificityThis antibody binds to Chimpanzee CDK9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDK9 (Cyclin Dependent Kinase 9) is a Protein Coding gene. Diseases associated with CDK9 include Central Nervous System Vasculitis and Laryngeal Tuberculosis. Among its related pathways are Formation of HIV elongation complex in the absence of HIV Tat and Gene Expression. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK12.
Product OverviewMouse Anti-Chimpanzee CDK9 Antibody is a mouse antibody against CDK9. It can be used for CDK9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-dependent kinase 9; CDK9
UniProt IDH2QXX8
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF.
For Research Use Only | Not For Clinical Use.
Online Inquiry