Mouse Anti-Chimpanzee CIAPIN1 Antibody (MO-AB-11379W)


Cat: MO-AB-11379W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO11379W
SpecificityThis antibody binds to Chimpanzee CIAPIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).
Product OverviewMouse Anti-Chimpanzee CIAPIN1 Antibody is a mouse antibody against CIAPIN1. It can be used for CIAPIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnamorsin; Cytokine-induced apoptosis inhibitor 1; Fe-S cluster assembly protein DRE2 homolog; CIAPIN1
UniProt IDK7CYA3
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENINQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKFSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKDKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA.
See other products for " CIAPIN1 "
MO-AB-43012WMouse Anti-Hamsters CIAPIN1 Antibody (MO-AB-43012W)
MO-AB-29552WMouse Anti-Dog CIAPIN1 Antibody (MO-AB-29552W)
MO-AB-14567YMouse Anti-Sheep CIAPIN1 Antibody (MO-AB-14567Y)
MO-AB-38464WMouse Anti-Gorilla CIAPIN1 Antibody (MO-AB-38464W)
CBMOAB-13536FYAMouse Anti-D. melanogaster Ciapin1 Antibody (CBMOAB-13536FYA)
MO-AB-00205RMouse Anti-Medaka ciapin1 Antibody (MO-AB-00205R)
MO-AB-34563WMouse Anti-Ferret CIAPIN1 Antibody (MO-AB-34563W)
MO-AB-44052WMouse Anti-Horse CIAPIN1 Antibody (MO-AB-44052W)
MO-AB-10906YMouse Anti-O. mykiss CIAPIN1 Antibody (MO-AB-10906Y)
CBMOAB-70535FYAMouse Anti-Zebrafish ciapin1 Antibody (CBMOAB-70535FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry