Mouse Anti-CLDN24 Antibody (MO-AB-12585W)


Cat: MO-AB-12585W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12585W Monoclonal Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) WB, ELISA MO12585W 100 µg
MO-AB-24828H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24828C 100 µg
MO-AB-29582W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29582W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Rat (Rattus norvegicus)
CloneMO12585W
SpecificityThis antibody binds to Chimpanzee CLDN24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is 75% identical to the mouse homolog. This gene is upstream of the CLDN22 gene, which overlaps the WWC2 gene on the opposite strand in the genome. (From NCBI)
Product OverviewMouse Anti-Chimpanzee CLDN24 Antibody is a mouse antibody against CLDN24. It can be used for CLDN24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesClaudin; CLDN24
UniProt IDH2QQH4
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MALIFRTAMQSVGLLLSFLGWILSIITTYLPHWKILNLDLNEMENWTMGLWQTCVIQEAVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRTGESQRDLKRRLLILGGILSWASGVTALVPVSWVAHKTVQEFWDENAPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYAVAQMQTQCPYLEDGTADPQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry