Mouse Anti-Chimpanzee CXCL5 Antibody (MO-AB-24132W)


Cat: MO-AB-24132W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO24132W
SpecificityThis antibody binds to Chimpanzee CXCL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL5 (C-X-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CXCL5 include Pediatric Ulcerative Colitis and Acute Cervicitis. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include chemokine activity and CXCR chemokine receptor binding. An important paralog of this gene is CXCL6.
Product OverviewMouse Anti-Chimpanzee CXCL5 Antibody is a mouse antibody against CXCL5. It can be used for CXCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C motif chemokine; CXCL5
UniProt IDH2QPN8
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAVGPQCSKVEVIASLKNGKEICLDPEAPFLKKVIQKILDSGNKEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry