Mouse Anti-Chimpanzee HPR Antibody (MO-AB-23198W)


Cat: MO-AB-23198W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO23198W
SpecificityThis antibody binds to Chimpanzee HPR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer.
Product OverviewMouse Anti-Chimpanzee HPR Antibody is a mouse antibody against HPR. It can be used for HPR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHaptoglobin-related protein; HPR
UniProt IDH2RDF7
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MSALGGVIAFLLWGRHLFSFYSGDYVMDISDDSCPKPPEIANGYGEHSIRYQCKNYYRLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLSHSENAIAKDIAPTLTLYVGEKQLVEIEKVVLYPNYSQVDIGLIKLKQKVLVNERVMPICLPSKDYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQDQCIRHYEGSTVPEKKAPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSTQDWVQKTIAEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry