Mouse Anti-Chimpanzee MRPS30 Antibody (MO-AB-10465W)


Cat: MO-AB-10465W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO10465W
SpecificityThis antibody binds to Chimpanzee MRPS30.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that is similar to the chicken pro-apoptotic protein p52. Transcript variants using alternative promoters or polyA sites have been mentioned in the literature but the complete description of these sequences is not available.
Product OverviewMouse Anti-Chimpanzee MRPS30 Antibody is a mouse antibody against MRPS30. It can be used for MRPS30 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial ribosomal protein S30; MRPS30
UniProt IDH2QQU9
Protein RefseqThe length of the protein is 439 amino acids long.
The sequence is show below: MAAARCWRPLLRGPRLSLHIAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN.
See other products for " mrps30 "
CBMOAB-87462FYAMouse Anti-Zebrafish mrps30 Antibody (CBMOAB-87462FYA)
MO-AB-05325HMouse Anti-Frog mrps30 Antibody (MO-AB-05325H)
MO-AB-16066RMouse Anti-Cattle MRPS30 Antibody (MO-AB-16066R)
CBMOAB-51771FYAMouse Anti-Rhesus MRPS30 Antibody (CBMOAB-51771FYA)
CBMOAB-06857HCBMouse Anti-C. elegans MRPS30 Antibody (CBMOAB-06857HCB)
MO-AB-59397WMouse Anti-Marmoset MRPS30 Antibody (MO-AB-59397W)
CBMOAB-24772FYAMouse Anti-D. melanogaster Mrps30 Antibody (CBMOAB-24772FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry