Mouse Anti-Chimpanzee NAT2 Antibody (MO-AB-14917W)


Cat: MO-AB-14917W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO14917W
SpecificityThis antibody binds to Chimpanzee NAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2).
Product OverviewMouse Anti-Chimpanzee NAT2 Antibody is a mouse antibody against NAT2. It can be used for NAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-acetyltransferase 2; Arylamine N-acetyltransferase; NAT2
UniProt IDH2QVT5
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPANKYSTGMVHLLLQVTIEGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPSIFRLTEERGIWYLDQIRREQYIPNKEFLNSHLLPKKKHQKIYFFTLEPRTVEDFESMNTYLQTSPTSSFITTSLCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRKLVPKPGDGSLTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry