AibGenesis™ Mouse Anti-ODF1 Antibody (MO-AB-10773W)


Cat: MO-AB-10773W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10773W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Goat (Capra hircus), Rat (Rattus norvegicus) WB, ELISA MO10773W 100 µg
MO-AB-17118R Monoclonal Cattle (Bos taurus) WB, ELISA MO17118R 100 µg
MO-AB-27651H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27651C 100 µg
MO-AB-37894W Monoclonal Goat (Capra hircus) WB, ELISA MO37894W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Goat (Capra hircus), Rat (Rattus norvegicus)
CloneMO10773W
SpecificityThis antibody binds to Chimpanzee ODF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. The human outer dense fibers contains at least 10 major proteins and this gene encodes the main protein. (From NCBI)
Product OverviewMouse Anti-Chimpanzee ODF1 Antibody is a mouse antibody against ODF1. It can be used for ODF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOuter dense fiber protein; ODF1
UniProt IDG2HE25
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCNPCNPCNPCSPCNPCNPCSPCNPCDPCNPCYPCGSRFSCRKMIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry