Mouse Anti-Chimpanzee PAG1 Antibody (MO-AB-18075W)


Cat: MO-AB-18075W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO18075W
SpecificityThis antibody binds to Chimpanzee PAG1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.
Product OverviewMouse Anti-Chimpanzee PAG1 Antibody is a mouse antibody against PAG1. It can be used for PAG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphoprotein associated with glycosphingolipid microdomains 1; PAG1
UniProt IDH2QWC2
Protein RefseqThe length of the protein is 432 amino acids long.
The sequence is show below: MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGPSLTVPESTYNSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPGEEPEPDYEAIHTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL.
See other products for " PAG1 "
CBMOAB-53760FYAMouse Anti-Rhesus PAG1 Antibody (CBMOAB-53760FYA)
MO-AB-60911WMouse Anti-Marmoset PAG1 Antibody (MO-AB-60911W)
CBMOAB-91272FYAMouse Anti-Zebrafish pag1 Antibody (CBMOAB-91272FYA)
CBMOAB-88464FYBMouse Anti-Rice PAG1 Antibody (CBMOAB-88464FYB)
MO-DKB-0358RARabbit Anti-PAG1 Antibody (MO-DKB-0358RA)
CBMOAB-38044FYCMouse Anti-Arabidopsis PAG1 Antibody (CBMOAB-38044FYC)
MO-AB-05984HMouse Anti-Frog pag1 Antibody (MO-AB-05984H)
For Research Use Only | Not For Clinical Use.
Online Inquiry