Mouse Anti-Chimpanzee PEX10 Antibody (MO-AB-12904W)


Cat: MO-AB-12904W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO12904W
SpecificityThis antibody binds to Chimpanzee PEX10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.
Product OverviewMouse Anti-Chimpanzee PEX10 Antibody is a mouse antibody against PEX10. It can be used for PEX10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeroxisomal biogenesis factor 10; PEX10
UniProt IDH2PXU8
Protein RefseqThe length of the protein is 326 amino acids long.
The sequence is show below: MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPSQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLAGITYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAISRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR.
See other products for " Pex10 "
CBMOAB-27469FYAMouse Anti-D. melanogaster Pex10 Antibody (CBMOAB-27469FYA)
CBMOAB-02903CRMouse Anti-Yeast PEX10 Antibody (CBMOAB-02903CR)
MO-AB-61311WMouse Anti-Marmoset PEX10 Antibody (MO-AB-61311W)
CBMOAB-92224FYAMouse Anti-Zebrafish pex10 Antibody (CBMOAB-92224FYA)
MO-AB-17774RMouse Anti-Cattle PEX10 Antibody (MO-AB-17774R)
CBMOAB-38640FYCMouse Anti-Arabidopsis PEX10 Antibody (CBMOAB-38640FYC)
CBMOAB-54294FYAMouse Anti-Rhesus PEX10 Antibody (CBMOAB-54294FYA)
MO-AB-05093WMouse Anti-Rhesus PEX10 Antibody (MO-AB-05093W)
For Research Use Only | Not For Clinical Use.
Online Inquiry