AibGenesis™ Mouse Anti-SERTM1 Antibody (MO-AB-23553W)


Cat: MO-AB-23553W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23553W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO23553W 100 µg
MO-AB-28932H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28932C 100 µg
MO-AB-64175W Monoclonal Marmoset WB, ELISA MO64175W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO23553W
SpecificityThis antibody binds to Chimpanzee SERTM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee SERTM1 Antibody is a mouse antibody against SERTM1. It can be used for SERTM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 13 open reading frame 36; SERTM1
UniProt IDH2Q7F4
Protein RefseqThe length of the protein is 107 amino acids long.
The sequence is show below: MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry