AibGenesis™ Mouse Anti-VDAC2 Antibody (MO-AB-14049W)


Cat: MO-AB-14049W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14049W Monoclonal Chimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Human (Homo sapiens), Dog (Canis lupus familiaris), Cat (Felis catus), Primate, Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Pig (Sus scrofa), Bovine (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Maize (Zea mays), Marmoset, Rice (Oryza) WB, ELISA MO14049W 100 µg
CBMOAB-62067FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62067FYA 100 µg
CBMOAB-15747FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO15747FYB 100 µg
CBMOAB-89806FYB Monoclonal Rice (Oryza) WB, ELISA MO89806FYB 100 µg
MO-AB-49803W Monoclonal Maize (Zea mays) WB, ELISA MO49803W 100 µg
MO-AB-67650W Monoclonal Marmoset WB, ELISA MO67650W 100 µg
MO-AB-22763R Monoclonal Cattle (Bos taurus) WB, ELISA MO22763R 100 µg
MO-AB-31186R Monoclonal Pig (Sus scrofa) WB, ELISA MO31186R 100 µg
MO-AB-09025H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09025C 100 µg
MO-AB-04735Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04735Y 100 µg
MO-AB-10459Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10459Y 100 µg
MO-DKB-00616W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA, IF, IHC, IHC-P, IP 100 µg
MO-DKB-01405W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg
MO-DKB-02533W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MO-DKB-03300W Polyclonal Human (Homo sapiens), Cattle (Bos taurus), Dog (Canis lupus familiaris), Cat (Felis catus), Primate, Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Human (Homo sapiens), Dog (Canis lupus familiaris), Cat (Felis catus), Primate, Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Pig (Sus scrofa), Bovine (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Maize (Zea mays), Marmoset, Rice (Oryza)
CloneMO14049W
SpecificityThis antibody binds to Chimpanzee VDAC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Chimpanzee VDAC2 Antibody is a mouse antibody against VDAC2. It can be used for VDAC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVoltage-dependent anion channel 2; VDAC2
UniProt IDK7C727
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA.
See other products for " VDAC2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry