Mouse Anti-VDAC2 Antibody (MO-AB-14049W)
Cat: MO-AB-14049W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-14049W | Monoclonal | Chimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Human (Homo sapiens), Dog (Canis lupus familiaris), Cat (Felis catus), Primate, Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Pig (Sus scrofa), Bovine (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Maize (Zea mays), Marmoset, Rice (Oryza) | WB, ELISA | MO14049W | 100 µg | ||
| CBMOAB-62067FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO62067FYA | 100 µg | ||
| CBMOAB-15747FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO15747FYB | 100 µg | ||
| CBMOAB-89806FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89806FYB | 100 µg | ||
| MO-AB-49803W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO49803W | 100 µg | ||
| MO-AB-67650W | Monoclonal | Marmoset | WB, ELISA | MO67650W | 100 µg | ||
| MO-AB-22763R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22763R | 100 µg | ||
| MO-AB-31186R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31186R | 100 µg | ||
| MO-AB-09025H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09025C | 100 µg | ||
| MO-AB-04735Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04735Y | 100 µg | ||
| MO-AB-10459Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10459Y | 100 µg | ||
| MO-DKB-00616W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, ELISA, IF, IHC, IHC-P, IP | 100 µg | |||
| MO-DKB-01405W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg | |||
| MO-DKB-02533W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
| MO-DKB-03300W | Polyclonal | Human (Homo sapiens), Cattle (Bos taurus), Dog (Canis lupus familiaris), Cat (Felis catus), Primate, Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Zebrafish (Danio rerio) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chimpanzee (Pan troglodytes), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Human (Homo sapiens), Dog (Canis lupus familiaris), Cat (Felis catus), Primate, Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Pig (Sus scrofa), Bovine (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Maize (Zea mays), Marmoset, Rice (Oryza) |
| Clone | MO14049W |
| Specificity | This antibody binds to Chimpanzee VDAC2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Chimpanzee VDAC2 Antibody is a mouse antibody against VDAC2. It can be used for VDAC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Voltage-dependent anion channel 2; VDAC2 |
| UniProt ID | K7C727 |
| Protein Refseq | The length of the protein is 294 amino acids long. The sequence is show below: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA. |
See other products for " VDAC2 "
| CBMOAB-45817FYC | Mouse Anti-VDAC2 Antibody (CBMOAB-45817FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry