AibGenesis™ Mouse Anti-ZNF576 Antibody (MO-AB-15751W)


Cat: MO-AB-15751W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15751W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset WB, ELISA MO15751W 100 µg
MO-AB-23336R Monoclonal Cattle (Bos taurus) WB, ELISA MO23336R 100 µg
MO-AB-68549W Monoclonal Marmoset WB, ELISA MO68549W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset
CloneMO15751W
SpecificityThis antibody binds to Chimpanzee ZNF576.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee ZNF576 Antibody is a mouse antibody against ZNF576. It can be used for ZNF576 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 576; ZNF576
UniProt IDH2R616
Protein RefseqThe length of the protein is 170 amino acids long.
The sequence is show below: MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQDFAQEAGLHQHYIRHARGEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry