AibGenesis™ Mouse Anti-CHMP1A Antibody (CBMOAB-39200FYA)


Cat: CBMOAB-39200FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39200FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39200FYA 100 µg
CBMOAB-70395FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70395FYA 100 µg
MO-AB-10169R Monoclonal Cattle (Bos taurus) WB, ELISA MO10169R 100 µg
MO-AB-24771H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24771C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39200FYA
SpecificityThis antibody binds to Rhesus CHMP1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. Several transcripts encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus CHMP1A Antibody is a mouse antibody against CHMP1A. It can be used for CHMP1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCHMP1A
UniProt IDF6TVW3
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry