Mouse Anti-chmp1b Antibody (CBMOAB-70397FYA)


Cat: CBMOAB-70397FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70397FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO70397FYA 100 µg
MO-AB-10170R Monoclonal Cattle (Bos taurus) WB, ELISA MO10170R 100 µg
MO-AB-24266W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24266W 100 µg
MO-AB-24772H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24772C 100 µg
MO-AB-52956W Monoclonal Marmoset WB, ELISA MO52956W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO70397FYA
SpecificityThis antibody binds to Zebrafish chmp1b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish chmp1b Antibody is a mouse antibody against chmp1b. It can be used for chmp1b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCharged multivesicular body protein 1b; Chromatin-modifying protein 1b; CHMP1b; chmp1b; NP_956308.
UniProt IDQ7ZVB1
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MSSMEKHLFNLKFAAKELQRNSKKCDKEEKAEKVKVKKAIQKGNMEVARIHAENAIRQKNQSVNFLRMSARVDAVAARVQTAVTMNQVTKSMAGVVKGMDATLKSMNLEKISGLMEKFERQFETLDVQTAQMEDSMSSTTTLTTPQGQVDTLMMEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLAKLRDQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry