AibGenesis™ Mouse Anti-CHMP4A Antibody (CBMOAB-39201FYA)


Cat: CBMOAB-39201FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39201FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO39201FYA 100 µg
MO-AB-10174R Monoclonal Cattle (Bos taurus) WB, ELISA MO10174R 100 µg
MO-AB-24529W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24529W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO39201FYA
SpecificityThis antibody binds to Rhesus CHMP4A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CHMP4A Antibody is a mouse antibody against CHMP4A. It can be used for CHMP4A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCharged multivesicular body protein 4a; CHMP4A
UniProt IDH9F342
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: HHPPRSKAEVWRTPRGVGGIGELAMSGLGRLFGKGKKEKGPIPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQGMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELELLEQEELAQELLSVGDKEEEPPVKLPSVPSTHLPAEPAPKADEDEEALKQLAEWVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry