AibGenesis™ Mouse Anti-CHP Antibody (MO-AB-00099W)


Cat: MO-AB-00099W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00099W Monoclonal Barrel medic (Medicago truncatula), D. melanogaster (Drosophila melanogaster), Insect WB, ELISA MO00099W 100 µg
MO-NAB-00628W Monoclonal D. melanogaster (Drosophila melanogaster), Insect IF, IHC, IP, WB NW0550 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), D. melanogaster (Drosophila melanogaster), Insect
CloneMO00099W
SpecificityThis antibody binds to Barrel medic CHP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for photoreceptor cell morphogenesis. Mediates homogenous cell adhesion. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Barrel medic CHP Antibody is a mouse antibody against CHP. It can be used for CHP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil-helix-coiled-coil-helix domain containing protein; Intermembrane space import and assembly protein; CHP; MTR_8g020800
UniProt IDQ4VYC7
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MGQAESAEAQPQTTTTTTTAVVSNSSSSDSTSLESVIAEAAAYGSQNTENVEEMAQKALECPCIADLRSGPCGFQFSEAFLCFLKSTSEEKGSDCVNPFIALQSCIKANPNAFSKDILGEDESKESEQVQEYKILPPDWSKESQKSKSRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry