Mouse Anti-CHP1 Antibody (CBMOAB-01472HCB)
Cat: CBMOAB-01472HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-01472HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO01472HB | 100 µg | ||
| CBMOAB-70428FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70428FYA | 100 µg | ||
| MO-AB-02390H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02390C | 100 µg | ||
| MO-AB-10186R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10186R | 100 µg | ||
| MO-AB-18391W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18391W | 100 µg | ||
| MO-AB-24783H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24783C | 100 µg | ||
| MO-AB-52973W | Monoclonal | Marmoset | WB, ELISA | MO52973W | 100 µg | ||
| MO-DKB-00800W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO01472HB |
| Specificity | This antibody binds to C. elegans CHP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. |
| Product Overview | Mouse Anti-C. elegans CHP1 Antibody is a mouse antibody against CHP1. It can be used for CHP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CHORD containing protein; Protein CHP-1; chp-1 chp |
| UniProt ID | G5EEI8 |
| Protein Refseq | The length of the protein is 321 amino acids long. The sequence is show below: MVDESKLQCYHKGCGLLFDPKENDNEACTYHPGGPYFHDAYKIWTCCDKKSTDFGTWMNYKGCTRGKHSNEKPVDIVKVAAVKEIRPEKEEDVIVWKGLNKSGKLDSKDATKRIEQNLNVEVTPGATAAIEKKLKEISEAAQSADIQIGAPCRNNGCSTEFDGSKNKENCQHHPGAAIFHEGMKYWSCCNKKTSNFGAFLEQVGCTSGEHKFRNNEIVSKFREDWFSSNGFVTINVYCRGALPETANIVSDGHTVRVSMKHGFGNASVDLDYDLWDEVIPEESRVVIGERKVEISLKQKHGTGWPRLKFDPELDAKNDEEA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry