Mouse Anti-CHPT1 Antibody (CBMOAB-39211FYA)


Cat: CBMOAB-39211FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39211FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO39211FYA 100 µg
CBMOAB-70434FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70434FYA 100 µg
MO-AB-01178Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01178Y 100 µg
MO-AB-10187R Monoclonal Cattle (Bos taurus) WB, ELISA MO10187R 100 µg
MO-AB-10620W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10620W 100 µg
MO-AB-52978W Monoclonal Marmoset WB, ELISA MO52978W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO39211FYA
SpecificityThis antibody binds to Rhesus CHPT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCHPT1 (Choline Phosphotransferase 1) is a Protein Coding gene. Among its related pathways are Glycerophospholipid biosynthesis and Metabolism. Gene Ontology (GO) annotations related to this gene include diacylglycerol binding and diacylglycerol cholinephosphotransferase activity. An important paralog of this gene is CEPT1.
Product OverviewMouse Anti-Rhesus CHPT1 Antibody is a mouse antibody against CHPT1. It can be used for CHPT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCholinephosphotransferase 1; CHPT1
UniProt IDH9EVL8
Protein RefseqThe length of the protein is 406 amino acids long.
The sequence is show below: MAAGAGARPAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLSTVFMAVGASIAARLGTHPDWLFVCSFIGMFVFYCAHWQTYVSGVLRFGKVDVTEIQIALVIVFVLSAFGGATMWDYTIPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIMIYKKSATNVFEKHPCLYTLMFGCVFAKVSQKLVIAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVVLWIAMVISSFDMVIYFSALCLQISRHLHLNIFKTTCHQAPEQVQVLSSKSHQNNMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry