Mouse Anti-CHST15 Antibody (CBMOAB-39244FYA)


Cat: CBMOAB-39244FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39244FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO39244FYA 100 µg
MO-AB-00201R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00201R 100 µg
MO-AB-00210L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00210L 100 µg
MO-AB-01200Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01200Y 100 µg
MO-AB-01643W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01643W 100 µg
MO-AB-07579Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07579Y 100 µg
MO-AB-10223R Monoclonal Cattle (Bos taurus) WB, ELISA MO10223R 100 µg
MO-AB-14562Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14562Y 100 µg
MO-AB-22624W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22624W 100 µg
MO-AB-24601R Monoclonal Pig (Sus scrofa) WB, ELISA MO24601R 100 µg
MO-AB-32905H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32905C 100 µg
MO-AB-34558W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34558W 100 µg
MO-AB-44046W Monoclonal Horse (Equus caballus) WB, ELISA MO44046W 100 µg
MO-AB-53005W Monoclonal Marmoset WB, ELISA MO53005W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO39244FYA
SpecificityThis antibody binds to Rhesus CHST15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionChondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component of the extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in which the C-4 and C-6 hydroxyl groups are sulfated. This gene encodes a type II transmembrane glycoprotein that acts as a sulfotransferase to transfer sulfate to the C-6 hydroxal group of chondroitin sulfate. This gene has also been identified as being co-expressed with RAG1 in B-cells and as potentially acting as a B-cell surface signaling receptor. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Rhesus CHST15 Antibody is a mouse antibody against CHST15. It can be used for CHST15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSulfotransferase; EC 2.8.2.-; CHST15
UniProt IDH9FB76
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: LRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT.
For Research Use Only | Not For Clinical Use.
Online Inquiry