AibGenesis™ Mouse Anti-CIB3 Antibody (CBMOAB-39267FYA)


Cat: CBMOAB-39267FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39267FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO39267FYA 100 µg
MO-AB-14570Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14570Y 100 µg
MO-AB-24794H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24794C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO39267FYA
SpecificityThis antibody binds to Rhesus CIB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CIB3 Antibody is a mouse antibody against CIB3. It can be used for CIB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCIB3
UniProt IDF6YZ19
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MGNKQTVFTHEQLEAYQDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNDDDYICAWDLEQTVTKLTRGELSAEEVSLVCEKVLDEADGDHDGRLSLEDFRNMILRAPDFLSTFHIRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry