Mouse Anti-CITED2 Antibody (CBMOAB-39290FYA)


Cat: CBMOAB-39290FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39290FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO39290FYA 100 µg
CBMOAB-70582FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70582FYA 100 µg
MO-AB-01213Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01213Y 100 µg
MO-AB-10261R Monoclonal Cattle (Bos taurus) WB, ELISA MO10261R 100 µg
MO-AB-14573Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14573Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO39290FYA
SpecificityThis antibody binds to Rhesus CITED2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Rhesus CITED2 Antibody is a mouse antibody against CITED2. It can be used for CITED2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCITED2
UniProt IDF7GL91
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGXPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKLPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry