AibGenesis™ Mouse Anti-CLDN23 Antibody (CBMOAB-39334FYA)
Cat: CBMOAB-39334FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39334FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO39334FYA | 100 µg | ||
| MO-AB-00238L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00238L | 100 µg | ||
| MO-AB-07623Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07623Y | 100 µg | ||
| MO-AB-10310R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10310R | 100 µg | ||
| MO-AB-23011W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23011W | 100 µg | ||
| MO-AB-23048H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23048C | 100 µg | ||
| MO-AB-24649R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24649R | 100 µg | ||
| MO-AB-34583W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34583W | 100 µg | ||
| MO-AB-44074W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44074W | 100 µg | ||
| MO-AB-53125W | Monoclonal | Marmoset | WB, ELISA | MO53125W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) |
| Clone | MO39334FYA |
| Specificity | This antibody binds to Rhesus CLDN23. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is expressed in germinal center B-cells, placenta and stomach as well as in colon tumor. This gene is down-regulated in intestinal type gastric cancer. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus CLDN23 Antibody is a mouse antibody against CLDN23. It can be used for CLDN23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CLDN23 |
| UniProt ID | F6Z989 |
| Protein Refseq | The length of the protein is 164 amino acids long. The sequence is show below: MRTPVVMTLGMVFAPCGLLASWTSHPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCKERRKAPSAGPRRSSVSTIQVEWPEPELTPAIKYYSDGQHRPPPAQHRKPKPKVGFPMPRPPPKAYTNSVDVLAGEGWEAAQSQDSTSCSSHPCGSTLPCDSDL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry