AibGenesis™ Mouse Anti-CLDND2 Antibody (CBMOAB-39335FYA)


Cat: CBMOAB-39335FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39335FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO39335FYA 100 µg
MO-AB-24843H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24843C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO39335FYA
SpecificityThis antibody binds to Rhesus CLDND2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CLDND2 Antibody is a mouse antibody against CLDND2. It can be used for CLDND2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLDND2
UniProt IDF6ZFP7
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: MGVKRSLQRGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSNIPCQTTLAVTAACMVLAVGVGVVGMVMGLRIRCHEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAG.
For Research Use Only | Not For Clinical Use.
Online Inquiry