AibGenesis™ Mouse Anti-clec9A Antibody (CBMOAB-39377FYA)


Cat: CBMOAB-39377FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39377FYA Monoclonal Rhesus (Macaca mulatta), Human (Homo sapiens), Primate, Rat (Rattus norvegicus) WB, ELISA MO39377FYA 100 µg
MO-AB-24877H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24877C 100 µg
MO-NAB-00175W Monoclonal Human (Homo sapiens), Primate, Rhesus (Macaca mulatta) WB 14N8D7 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Human (Homo sapiens), Primate, Rat (Rattus norvegicus)
CloneMO39377FYA
SpecificityThis antibody binds to Rhesus clec9A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus clec9A Antibody is a mouse antibody against clec9A. It can be used for clec9A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-type lectin domain family 9 member A; clec9A
UniProt IDW6B699
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MHEEEIYTSLQWDSPAPNTYQKCLSSNKCSGAWCLVMVISCIFCMGLLTASIFLGVKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSHVLQMKFCQTFMQSSFSSAHNCSPCPNNWIQNRESCYYVSEHWKIWHTSQENCLKEGSTLLQIESEEEMDFITGSLRKIRGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPVEISQSTNQVCGYIKNSSLLSSNCSTWKYFICEKYALRSSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry