Mouse Anti-CLIC1 Antibody (CBMOAB-01819HCB)
Cat: CBMOAB-01819HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-01819HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO01819HB | 100 µg | ||
| CBMOAB-39379FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39379FYA | 100 µg | ||
| CBMOAB-70747FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70747FYA | 100 µg | ||
| MO-AB-02464H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02464C | 100 µg | ||
| MO-AB-07632Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07632Y | 100 µg | ||
| MO-AB-10339R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10339R | 100 µg | ||
| MO-AB-17354W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17354W | 100 µg | ||
| MO-AB-24878H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24878C | 100 µg | ||
| MO-AB-36891W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36891W | 100 µg | ||
| MO-AB-53143W | Monoclonal | Marmoset | WB, ELISA | MO53143W | 100 µg | ||
| MO-AB-69474W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO69474W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO01819HB |
| Specificity | This antibody binds to C. elegans CLIC1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Golgi apparatus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. |
| Product Overview | Mouse Anti-C. elegans CLIC1 Antibody is a mouse antibody against CLIC1. It can be used for CLIC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein CLIC-1; clic-1 |
| UniProt ID | P90961 |
| Protein Refseq | The length of the protein is 226 amino acids long. The sequence is show below: MSDPVADFLAREQNLFADFDGAPPAAAAANPDAPEADAPAPALDDDFGDLQIAGDEPPPVVHPTDSGVDLDGLVDDNAAAPAIVVPAVEPMVNGNHSASSGGSKGPSPILSTVPRIEAEKIRLWKAQQEQLLSKKDEAEEKKKIELRANAKKELEEWYKQREKTLQLSHDENLKNEKSNQELFAKQQDGDAQWETVNKLVDQQKSKSGKDLSRLKTLLAGLKHAGK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry