Mouse Anti-CLIC3 Antibody (CBMOAB-39384FYA)


Cat: CBMOAB-39384FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39384FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO39384FYA 100 µg
MO-AB-02465H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02465C 100 µg
MO-AB-10341R Monoclonal Cattle (Bos taurus) WB, ELISA MO10341R 100 µg
MO-AB-11867W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11867W 100 µg
MO-AB-23055H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23055C 100 µg
MO-AB-24880H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24880C 100 µg
MO-AB-53146W Monoclonal Marmoset WB, ELISA MO53146W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Rat (Rattus norvegicus)
CloneMO39384FYA
SpecificityThis antibody binds to Rhesus CLIC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionChloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.
Product OverviewMouse Anti-Rhesus CLIC3 Antibody is a mouse antibody against CLIC3. It can be used for CLIC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLIC3
UniProt IDF7EEV4
Protein RefseqThe length of the protein is 234 amino acids long.
The sequence is show below: MAETKLQLFVKASEDGEVGHCPSCQRLFMVLLLKGVPFTLTTVDTRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELALEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAGLPGVRRYLDSALQEKEFKYTCPHSAEILAAYRPAVHPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry