Mouse Anti-CLK1 Antibody (CBMOAB-01820HCB)
Cat: CBMOAB-01820HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-01820HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO01820HB | 100 µg | ||
| CBMOAB-39396FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39396FYA | 100 µg | ||
| MO-AB-02472H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02472C | 100 µg | ||
| MO-AB-23057H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23057C | 100 µg | ||
| MO-AB-24680R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24680R | 100 µg | ||
| MO-AB-29592W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29592W | 100 µg | ||
| MO-AB-36892W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36892W | 100 µg | ||
| MO-AB-44081W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44081W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rhesus (Macaca mulatta) |
| Clone | MO01820HB |
| Specificity | This antibody binds to C. elegans CLK1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The choice of splice sites during pre-mRNA processing may be regulated by the concentration of transacting factors, including serine/arginine rich proteins. Therefore, the encoded protein may play an indirect role in governing splice site selection. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans CLK1 Antibody is a mouse antibody against CLK1. It can be used for CLK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ubiquinone biosynthesis protein COQ7 homolog; Clock abnormal protein 1; Protein clk-1; clk-1 |
| UniProt ID | P48376 |
| Protein Refseq | The length of the protein is 187 amino acids long. The sequence is show below: MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGAIAIAEKI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry