Mouse Anti-CLK1 Antibody (CBMOAB-01820HCB)
Cat: CBMOAB-01820HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-01820HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO01820HB | 100 µg | ||
CBMOAB-39396FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39396FYA | 100 µg | ||
MO-AB-02472H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02472C | 100 µg | ||
MO-AB-23057H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23057C | 100 µg | ||
MO-AB-24680R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24680R | 100 µg | ||
MO-AB-29592W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29592W | 100 µg | ||
MO-AB-36892W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36892W | 100 µg | ||
MO-AB-44081W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44081W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rhesus (Macaca mulatta) |
Clone | MO01820HB |
Specificity | This antibody binds to C. elegans CLK1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The choice of splice sites during pre-mRNA processing may be regulated by the concentration of transacting factors, including serine/arginine rich proteins. Therefore, the encoded protein may play an indirect role in governing splice site selection. Multiple transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-C. elegans CLK1 Antibody is a mouse antibody against CLK1. It can be used for CLK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ubiquinone biosynthesis protein COQ7 homolog; Clock abnormal protein 1; Protein clk-1; clk-1 |
UniProt ID | P48376 |
Protein Refseq | The length of the protein is 187 amino acids long. The sequence is show below: MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGAIAIAEKI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry