Mouse Anti-CLNS1A Antibody (CBMOAB-39408FYA)


Cat: CBMOAB-39408FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39408FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Goat (Capra hircus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39408FYA 100 µg
CBMOAB-70790FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70790FYA 100 µg
MO-AB-07637Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07637Y 100 µg
MO-AB-23631W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23631W 100 µg
MO-AB-24886H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24886C 100 µg
MO-AB-29600W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29600W 100 µg
MO-AB-36893W Monoclonal Goat (Capra hircus) WB, ELISA MO36893W 100 µg
MO-AB-53178W Monoclonal Marmoset WB, ELISA MO53178W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Goat (Capra hircus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39408FYA
SpecificityThis antibody binds to Rhesus CLNS1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma Membrane; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus CLNS1A Antibody is a mouse antibody against CLNS1A. It can be used for CLNS1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLNS1A
UniProt IDF7A857
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEGMYANYILKKSDNNQCNIEAIDSFWIVFVNTVAFLEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry