Mouse Anti-Clp Antibody (CBMOAB-13630FYA)


Cat: CBMOAB-13630FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-13630FYA Monoclonal Fruit fly (Drosophila melanogaster), Rice (Oryza), Shrimp white spot syndrome virus WB, ELISA MO13630FYA 100 µg
CBMOAB-22241FYB Monoclonal Rice (Oryza) WB, ELISA MO22241FYB 100 µg
MO-AB-30152H Monoclonal Shrimp white spot syndrome virus WB, ELISA MO30152C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Rice (Oryza), Shrimp white spot syndrome virus
CloneMO13630FYA
SpecificityThis antibody binds to fruit fly Clp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Clp Antibody is a mouse antibody against Clp. It can be used for Clp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCleavage and polyadenylation specificity factor subunit 4; EC 3.1.-.-; Cleavage and polyadenylation specificity factor 30 kDa subunit; Protein clipper; Clp; CPSF30 Ssb-c6a
UniProt IDQ9VPT8
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAELGKDQLHKKLPTCHYCGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSGGYSGHSGHIEGADDMQSNHHSQPHGPGFVKVPTPLEEITCYKCGNKGHYANKCPKGHLAFLSNQHSHK.
For Research Use Only | Not For Clinical Use.
Online Inquiry