Mouse Anti-CLPP Antibody (CBMOAB-39415FYA)
Cat: CBMOAB-39415FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-39415FYA | Monoclonal | Rhesus (Macaca mulatta), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), E. coli (Escherichia coli ), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rice (Oryza), Sheep (Ovis aries), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) | WB, ELISA | MO39415FYA | 100 µg | ||
CBMOAB-0382YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0382YC | 100 µg | ||
CBMOAB-70798FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70798FYA | 100 µg | ||
CBMOAB-22251FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO22251FYB | 100 µg | ||
MO-AB-00105W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00105W | 100 µg | ||
MO-AB-02381W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02381W | 100 µg | ||
MO-AB-09356W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09356W | 100 µg | ||
MO-AB-26557W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26557W | 100 µg | ||
MO-AB-29602W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29602W | 100 µg | ||
MO-AB-34593W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34593W | 100 µg | ||
MO-AB-41422W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41422W | 100 µg | ||
MO-AB-44086W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44086W | 100 µg | ||
MO-AB-53184W | Monoclonal | Marmoset | WB, ELISA | MO53184W | 100 µg | ||
MO-AB-10357R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10357R | 100 µg | ||
MO-AB-00219R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00219R | 100 µg | ||
MO-AB-02480H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02480C | 100 µg | ||
MO-AB-30254H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30254C | 100 µg | ||
MO-AB-00248L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00248L | 100 µg | ||
MO-AB-01806L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01806L | 100 µg | ||
MO-AB-06379Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06379Y | 100 µg | ||
MO-AB-07640Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07640Y | 100 µg | ||
MO-AB-14635Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14635Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), E. coli (Escherichia coli ), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rice (Oryza), Sheep (Ovis aries), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) |
Clone | MO39415FYA |
Specificity | This antibody binds to Rhesus CLPP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. |
Product Overview | Mouse Anti-Rhesus CLPP Antibody is a mouse antibody against CLPP. It can be used for CLPP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-dependent Clp protease proteolytic subunit; EC 3.4.21.92; CLPP |
UniProt ID | H9YXF7 |
Protein Refseq | The length of the protein is 277 amino acids long. The sequence is show below: MWPAILVGGARVAACRYPALGPRLAAHFPAQRTPQRTPQNGLALQRSLHATAARALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGSPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST. |
For Research Use Only | Not For Clinical Use.
Online Inquiry