AibGenesis™ Mouse Anti-CLPSL2 Antibody (CBMOAB-39418FYA)


Cat: CBMOAB-39418FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39418FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO39418FYA 100 µg
MO-AB-24889H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24889C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO39418FYA
SpecificityThis antibody binds to Rhesus CLPSL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CLPSL2 Antibody is a mouse antibody against CLPSL2. It can be used for CLPSL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLPSL2
UniProt IDF6SGC0
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: ILAGAVMPLWSSLPQYKKKITDRCFHHSECYSGCCLMDLESGGAFCAPRARITMICLPQTKGATNIICPCRVGLTCISKDLMCASRCHMI.
For Research Use Only | Not For Clinical Use.
Online Inquiry