AibGenesis™ Mouse Anti-CLRN3 Antibody (MO-AB-10363R)


Cat: MO-AB-10363R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10363R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO10363R 100 µg
MO-AB-24897H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24897C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO10363R
SpecificityThis antibody binds to Cattle CLRN3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CLRN3 Antibody is a mouse antibody against CLRN3. It can be used for CLRN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLRN3 protein; CLRN3
UniProt IDA6H7D9
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MPTAKKTLTFLLSFVTSLGAFIVLCFVLATQQWIRSTIAISDSSSNGSVIITYGLLRGKSIQELNHGLAESDKNFEVLGTLTNSSPKTLHSVVIVFLALGLFSSLLSAGFTFCNSVSNPYQTFLGPTGVYTWSGLSASFTFITMVLFVGNTQSNRLSEELAQRLYPLYPAATQQGTTHAYRYSFWLTLLVILLNVVTTVIIIFYQKARYQRKQEQRKPMESAPRDGILF.
For Research Use Only | Not For Clinical Use.
Online Inquiry