AibGenesis™ Mouse Anti-CLYBL Antibody (CBMOAB-39453FYA)


Cat: CBMOAB-39453FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39453FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO39453FYA 100 µg
MO-AB-10376R Monoclonal Cattle (Bos taurus) WB, ELISA MO10376R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO39453FYA
SpecificityThis antibody binds to Rhesus CLYBL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CLYBL Antibody is a mouse antibody against CLYBL. It can be used for CLYBL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCLYBL
UniProt IDF7HD24
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: NEARLRIVKTLEDFDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKIGPQVGLFLDAVVFGGEDFRASIGVKDLSLSLFVCVYMCVYIFSLPLHLHNNVYLPTVTMVFHDNGMDTTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry