AibGenesis™ Mouse Anti-CMC2 Antibody (CBMOAB-39461FYA)


Cat: CBMOAB-39461FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39461FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Yeast, Zebrafish (Danio rerio) WB, ELISA MO39461FYA 100 µg
CBMOAB-70859FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70859FYA 100 µg
CBMOAB-00757CR Monoclonal Yeast WB, ELISA MO00757CR 100 µg
MO-AB-53230W Monoclonal Marmoset WB, ELISA MO53230W 100 µg
MO-AB-10381R Monoclonal Cattle (Bos taurus) WB, ELISA MO10381R 100 µg
MO-AB-02493H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02493C 100 µg
MO-AB-24905H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24905C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Yeast, Zebrafish (Danio rerio)
CloneMO39461FYA
SpecificityThis antibody binds to Rhesus CMC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CMC2 Antibody is a mouse antibody against CMC2. It can be used for CMC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMC2
UniProt IDF7H398
Protein RefseqThe length of the protein is 51 amino acids long.
The sequence is show below: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDFDREVRKCLRKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry