AibGenesis™ Mouse Anti-CMC2 Antibody (CBMOAB-39461FYA)
Cat: CBMOAB-39461FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39461FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO39461FYA | 100 µg | ||
| CBMOAB-70859FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70859FYA | 100 µg | ||
| CBMOAB-00757CR | Monoclonal | Yeast | WB, ELISA | MO00757CR | 100 µg | ||
| MO-AB-53230W | Monoclonal | Marmoset | WB, ELISA | MO53230W | 100 µg | ||
| MO-AB-10381R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10381R | 100 µg | ||
| MO-AB-02493H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02493C | 100 µg | ||
| MO-AB-24905H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24905C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Yeast, Zebrafish (Danio rerio) |
| Clone | MO39461FYA |
| Specificity | This antibody binds to Rhesus CMC2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus CMC2 Antibody is a mouse antibody against CMC2. It can be used for CMC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CMC2 |
| UniProt ID | F7H398 |
| Protein Refseq | The length of the protein is 51 amino acids long. The sequence is show below: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDFDREVRKCLRKE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry