Mouse Anti-CMC4 Antibody (CBMOAB-00758CR)
Cat: CBMOAB-00758CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00758CR | Monoclonal | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO00758CR | 100 µg | ||
CBMOAB-63900FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO63900FYA | 100 µg | ||
MO-AB-10382R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10382R | 100 µg | ||
MO-AB-21747W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21747W | 100 µg | ||
MO-AB-53231W | Monoclonal | Marmoset | WB, ELISA | MO53231W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) |
Clone | MO00758CR |
Specificity | This antibody binds to Yeast CMC4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria. |
Product Overview | Mouse Anti-Yeast CMC4 Antibody is a mouse antibody against CMC4. It can be used for CMC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cx9C motif-containing protein 4, mitochondrial; CMC4; YMR194C-B |
UniProt ID | Q3E7A9 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MSNPCQKEACAIQDCLLSHQYDDAKCAKVIDQLYICCSKFYNDNGKDSRSPCCPLPSLLELKMKQRKLTPGDS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry