Mouse Anti-CMC4 Antibody (CBMOAB-00758CR)


Cat: CBMOAB-00758CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00758CR Monoclonal Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO00758CR 100 µg
CBMOAB-63900FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO63900FYA 100 µg
MO-AB-10382R Monoclonal Cattle (Bos taurus) WB, ELISA MO10382R 100 µg
MO-AB-21747W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21747W 100 µg
MO-AB-53231W Monoclonal Marmoset WB, ELISA MO53231W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO00758CR
SpecificityThis antibody binds to Yeast CMC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Product OverviewMouse Anti-Yeast CMC4 Antibody is a mouse antibody against CMC4. It can be used for CMC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCx9C motif-containing protein 4, mitochondrial; CMC4; YMR194C-B
UniProt IDQ3E7A9
Protein RefseqThe length of the protein is 73 amino acids long. The sequence is show below: MSNPCQKEACAIQDCLLSHQYDDAKCAKVIDQLYICCSKFYNDNGKDSRSPCCPLPSLLELKMKQRKLTPGDS.
For Research Use Only | Not For Clinical Use.
Online Inquiry