Mouse Anti-CMPK1 Antibody (CBMOAB-39463FYA)
Cat: CBMOAB-39463FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-39463FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO39463FYA | 100 µg | ||
MO-AB-07649Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07649Y | 100 µg | ||
MO-AB-10387R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10387R | 100 µg | ||
MO-AB-10945Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10945Y | 100 µg | ||
MO-AB-14639Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14639Y | 100 µg | ||
MO-AB-20307W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20307W | 100 µg | ||
MO-AB-24910H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24910C | 100 µg | ||
MO-AB-29613W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29613W | 100 µg | ||
MO-AB-32934H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32934C | 100 µg | ||
MO-AB-34602W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34602W | 100 µg | ||
MO-AB-36895W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36895W | 100 µg | ||
MO-AB-53233W | Monoclonal | Marmoset | WB, ELISA | MO53233W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO39463FYA |
Specificity | This antibody binds to Rhesus CMPK1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. (From NCBI) |
Product Overview | Mouse Anti-Rhesus CMPK1 Antibody is a mouse antibody against CMPK1. It can be used for CMPK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CMPK1 |
UniProt ID | F7GRA8 |
Protein Refseq | The length of the protein is 169 amino acids long. The sequence is show below: MLSRCRSRLLHVLGLSFLLQTRRPILFCPPRLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNENSDIPSVNKANY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry