Mouse Anti-Cmtm6 Antibody (MO-AB-24916H)


Cat: MO-AB-24916H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24916H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO24916C 100 µg
CBMOAB-70879FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70879FYA 100 µg
MO-AB-53241W Monoclonal Marmoset WB, ELISA MO53241W 100 µg
MO-AB-10391R Monoclonal Cattle (Bos taurus) WB, ELISA MO10391R 100 µg
MO-DKB-00684W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Primat, Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO24916C
SpecificityThis antibody binds to Rat Cmtm6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Endosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. (From NCBI)
Product OverviewThis product is a mouse antibody against Cmtm6. It can be used for Cmtm6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCKLF-like MARVEL transmembrane domain containing 6; Da2-17; LRRGT00102; Protein Cmtm6; RCG25476; Cmtm6
UniProt IDQ7TNZ9
Protein RefseqThe length of the protein is 183 amino acids long.
The sequence is show below: MENGAVYSPTTEAAPGAGRGARSGLAAYFFLGRLPWYRRILKGLQLLLSLLAFICEEVVSECGLCGGLYFFEFVSCSAFLLSLLLLIVYCTAVYDRVDTGKVKSSDFYITLGTGCVFLLASIIFVSTHSGTSAEIAAIVFGFLGSSMFLLDFVVMLCEKLRESPLRKPENNARAEALTEPLNA.
For Research Use Only | Not For Clinical Use.
Online Inquiry