Mouse Anti-COG7 Antibody (MO-AB-10468R)


Cat: MO-AB-10468R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10468R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO10468R 100 µg
CBMOAB-13701FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO13701FYA 100 µg
CBMOAB-39595FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO39595FYA 100 µg
CBMOAB-71082FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71082FYA 100 µg
MO-AB-03545W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03545W 100 µg
MO-AB-14835W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14835W 100 µg
MO-AB-53322W Monoclonal Marmoset WB, ELISA MO53322W 100 µg
MO-AB-02532H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02532C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO10468R
SpecificityThis antibody binds to Cattle COG7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOG7 (Component Of Oligomeric Golgi Complex 7) is a Protein Coding gene. Diseases associated with COG7 include Congenital Disorder Of Glycosylation, Type Ii and Congenital Disorder Of Glycosylation, Type In. Among its related pathways are Transport to the Golgi and subsequent modification and Metabolism of proteins.
Product OverviewMouse Anti-Cattle COG7 Antibody is a mouse antibody against COG7. It can be used for COG7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesConserved oligomeric Golgi complex subunit 7; COG complex subunit 7; Component of oligomeric Golgi complex 7; COG7
UniProt IDA2VDR8
Protein RefseqThe length of the protein is 770 amino acids long.
The sequence is show below: MDFSKFLAEDFDVKEWINAAFRAGPKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETSHQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQSIDQSKMFVKVFSEIDRMPQLLAYYYKCHKVQLLAAWQELCQTDLPLDRQLTGLYD.
See other products for " COG7 "
For Research Use Only | Not For Clinical Use.
Online Inquiry