AibGenesis™ Mouse Anti-col28a1 Antibody (CBMOAB-71182FYA)


Cat: CBMOAB-71182FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-71182FYA Monoclonal Zebrafish (Danio rerio), Marmoset WB, ELISA MO71182FYA 100 µg
MO-AB-53338W Monoclonal Marmoset WB, ELISA MO53338W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset
CloneMO71182FYA
SpecificityThis antibody binds to Zebrafish col28a1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish col28a1 Antibody is a mouse antibody against col28a1. It can be used for col28a1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namescol28a1; Collagen Type XXVIII Alpha 1 Chain
UniProt IDA5WUK1
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: PGDPGVGFPGAKGEKGSQGRPGPTGPVGIGEPGMPGPPGTQGVQGNQGFPGEGLPGQKGDRGFEGPKGVRGPPGSSIKGDKGNTGERGLPGLVGFPGAGIQGEKGDLGPIGPPGPRGPPGVGLVGPKGDQGFPGESGPQGERGIGEPGPKGEPGPVGAPGIPGIPGEDGSVGPKGEMGLSGERGQEGSPGKGIPGEKGDRGDRGSRGPPGSSGAAGPPGAKGEPGSLGMMGLPGPSGRGLPGAKGEPGPAGPPGHVGEPGVGTTGPKGDRGSPGPVGPQGMKGDGYPGPQGLPGLPGLPGEIGPEGQGIPGPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry