Mouse Anti-COL8A1 Antibody (CBMOAB-39683FYA)


Cat: CBMOAB-39683FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39683FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO39683FYA 100 µg
MO-AB-01339Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01339Y 100 µg
MO-AB-07673Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07673Y 100 µg
MO-AB-10530R Monoclonal Cattle (Bos taurus) WB, ELISA MO10530R 100 µg
MO-AB-14297W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14297W 100 µg
MO-AB-53358W Monoclonal Marmoset WB, ELISA MO53358W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO39683FYA
SpecificityThis antibody binds to Rhesus COL8A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOL8A1 (Collagen Type VIII Alpha 1 Chain) is a Protein Coding gene. Diseases associated with COL8A1 include Corneal Dystrophy and Macular Degeneration, Age-Related, 1. Among its related pathways are Integrin Pathway and ERK Signaling. An important paralog of this gene is COL8A2.
Product OverviewMouse Anti-Rhesus COL8A1 Antibody is a mouse antibody against COL8A1. It can be used for COL8A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOL8A1
UniProt IDF7H1M7
Protein RefseqThe length of the protein is 744 amino acids long.
The sequence is show below: MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGVGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGLKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGLKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGVGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPALMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM.
For Research Use Only | Not For Clinical Use.
Online Inquiry