Mouse Anti-commd2 Antibody (CBMOAB-71273FYA)


Cat: CBMOAB-71273FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-71273FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO71273FYA 100 µg
MO-AB-02558H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02558C 100 µg
MO-AB-10538R Monoclonal Cattle (Bos taurus) WB, ELISA MO10538R 100 µg
MO-AB-19919W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19919W 100 µg
MO-AB-24969H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24969C 100 µg
MO-AB-53371W Monoclonal Marmoset WB, ELISA MO53371W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO71273FYA
SpecificityThis antibody binds to Zebrafish commd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOMMD2 (COMM Domain Containing 2) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish commd2 Antibody is a mouse antibody against commd2. It can be used for commd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOMM domain containing 2; commd
UniProt IDQ6DH33
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MLLVLSEEHKEHLGFLSEVDPAVVGEFGRIAVEFLKKGSNPKIYEGAARKLSVSSESVQHGVEGLMFLLTESSKLMISELDFQDSVLVLGFPEQLNDLLLQLYLENRKEIRQILSKLAPSIPQYHNLEWRLDVQLASRALRHQVKPTVTMKLHLEDGAKRSAHVLQTDPATLQHLIQELERALAELKSNHCRRILRNIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry