AibGenesis™ Mouse Anti-COMMD4 Antibody (CBMOAB-39708FYA)


Cat: CBMOAB-39708FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39708FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39708FYA 100 µg
CBMOAB-71276FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71276FYA 100 µg
MO-AB-02561H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02561C 100 µg
MO-AB-10542R Monoclonal Cattle (Bos taurus) WB, ELISA MO10542R 100 µg
MO-AB-22573W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22573W 100 µg
MO-AB-24971H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24971C 100 µg
MO-AB-53374W Monoclonal Marmoset WB, ELISA MO53374W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39708FYA
SpecificityThis antibody binds to Rhesus COMMD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOMMD4 (COMM Domain Containing 4) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus COMMD4 Antibody is a mouse antibody against COMMD4. It can be used for COMMD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOMM domain-containing protein 4; COMMD4
UniProt IDH9F558
Protein RefseqThe length of the protein is 185 amino acids long.
The sequence is show below: VLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADTKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLRSVEEPMVHLRLEAAAAPGTPAQPVAMSLSADKFQVLLTELKQAQTLMSSLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry